| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein kinase pim-2 |
|---|
| Ligand | BDBM50162815 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1570461 (CHEMBL3794688) |
|---|
| Ki | <3±n/a nM |
|---|
| Citation |  Nishiguchi, GA; Burger, MT; Han, W; Lan, J; Atallah, G; Tamez, V; Lindvall, M; Bellamacina, C; Garcia, P; Feucht, P; Zavorotinskaya, T; Dai, Y; Wong, K Design, synthesis and structure activity relationship of potent pan-PIM kinase inhibitors derived from the pyridyl carboxamide scaffold. Bioorg Med Chem Lett26:2328-32 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine/threonine-protein kinase pim-2 |
|---|
| Name: | Serine/threonine-protein kinase pim-2 |
|---|
| Synonyms: | PIM2 | PIM2_HUMAN | Pim-2h | Serine/threonine-protein kinase (PIM2) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase pim-2 (PIM2) |
|---|
| Type: | Serine/threonine-protein kinase |
|---|
| Mol. Mass.: | 34185.93 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9P1W9 |
|---|
| Residue: | 311 |
|---|
| Sequence: | MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
GPAPLAWSLLP
|
|
|
|---|
| BDBM50162815 |
|---|
| n/a |
|---|
| Name | BDBM50162815 |
|---|
| Synonyms: | CHEMBL3793035 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H18FN7O |
|---|
| Mol. Mass. | 415.423 |
|---|
| SMILES | Cc1cc(nc(N)n1)-c1ccncc1NC(=O)c1nc(ccc1N)-c1ccccc1F |
|---|
| Structure | 
|
|---|
Search and Browse
