Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHepsin
LigandBDBM50158150
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1565753
Ki 670±n/a nM
Citation Venukadasula PKOwusu BYBansal NRoss LJHobrath JVBao DTruss JWStackhouse MMessick TEKlampfer LGalemmo RA Design and Synthesis of Nonpeptide Inhibitors of Hepatocyte Growth Factor Activation. ACS Med Chem Lett 7:177-81 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Hepsin
Name:Hepsin
Synonyms:Serine protease hepsin | Transmembrane protease, serine 1
Type:Enzyme
Mol. Mass.:45016.98
Organism:Homo sapiens (Human)
Description:Human deglycosylated hepsin was expressed in Pichia pastoris.
Residue:417
Sequence:
MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSAD
ARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCV
DEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSL
RYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYH
GGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQ
YYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCE
DSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50158150
n/a
NameBDBM50158150
Synonyms:CHEMBL3780005
TypeSmall organic molecule
Emp. Form.C30H36N6O3S
Mol. Mass.560.71
SMILESNC(=N)c1cccc(c1)N1CC(CN(CC2CCN(Cc3ccccc3)CC2)C1=O)NS(=O)(=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: