Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50157865 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1569753 (CHEMBL3791697) |
---|
Ki | 29±n/a nM |
---|
Citation | Lan, Y; Songyang, Y; Zhang, L; Peng, Y; Song, J Synthesis and biological evaluation of novel 6,7-dihydro-5H-cyclopenta[d]pyrimidine and 5,6,7,8-tetrahydroquinazoline derivatives as sigma-1 (s1) receptor antagonists for the treatment of pain. Bioorg Med Chem Lett26:2051-6 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM50157865 |
---|
n/a |
---|
Name | BDBM50157865 |
Synonyms: | CHEMBL3786829 |
Type | Small organic molecule |
Emp. Form. | C24H30F3N3O |
Mol. Mass. | 433.5097 |
SMILES | CC1CCN(CCCOc2nc(nc3CCCCc23)-c2ccc(cc2)C(F)(F)F)CC1 |
Structure |
|