Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein arginine methyltransferase 8 (PRMT8)
LigandBDBM50158095
Substrate/Competitorn/a
Meas. Tech.ChEBML_1564311
IC50 7000±n/a nM
Citation Ferreira de Freitas REram MSSzewczyk MMSteuber HSmil DWu HLi FSenisterra GDong ABrown PJHitchcock MMoosmayer DStegmann CMEgner UArrowsmith CBarsyte-Lovejoy DVedadi MSchapira M Discovery of a Potent Class I Protein Arginine Methyltransferase Fragment Inhibitor. J Med Chem 59:1176-83 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Protein arginine methyltransferase 8 (PRMT8)
Name:Protein arginine N-methyltransferase 8
Synonyms:HRMT1L3 | HRMT1L4 | Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4 | PRMT8 | Protein arginine N-methyltransferase 8 | Protein arginine N-methyltransferase 8 (PRMT8)
Type:Protein
Mol. Mass.:45293.70
Organism:Homo sapiens (Human)
Description:n/a
Residue:394
Sequence:
MGMKHSSRCLLLRRKMAENAAESTEVNSPPSQPPQPVVPAKPVQCVHHVSTQPSCPGRGK
MSKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGS
GTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVD
IIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWE
NVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQR
NDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISM
KPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50158095
n/a
NameBDBM50158095
Synonyms:CHEMBL3780444
TypeSmall organic molecule
Emp. Form.C5H14N2
Mol. Mass.102.1781
SMILESCNCCN(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: