Reaction Details |
| Report a problem with these data |
Target | Melanin-concentrating hormone receptor 1 |
---|
Ligand | BDBM119755 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1566584 (CHEMBL3791478) |
---|
IC50 | 3±n/a nM |
---|
Citation | Johansson, A; Löfberg, C; Antonsson, M; von Unge, S; Hayes, MA; Judkins, R; Ploj, K; Benthem, L; Lindén, D; Brodin, P; Wennerberg, M; Fredenwall, M; Li, L; Persson, J; Bergman, R; Pettersen, A; Gennemark, P; Hogner, A Discovery of (3-(4-(2-Oxa-6-azaspiro[3.3]heptan-6-ylmethyl)phenoxy)azetidin-1-yl)(5-(4-methoxyphenyl)-1,3,4-oxadiazol-2-yl)methanone (AZD1979), a Melanin Concentrating Hormone Receptor 1 (MCHr1) Antagonist with Favorable Physicochemical Properties. J Med Chem59:2497-511 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Melanin-concentrating hormone receptor 1 |
---|
Name: | Melanin-concentrating hormone receptor 1 |
Synonyms: | Gpr24 | MCHR1_MOUSE | Mchr1 | Slc1 |
Type: | PROTEIN |
Mol. Mass.: | 39133.74 |
Organism: | Mus musculus |
Description: | ChEMBL_818502 |
Residue: | 353 |
Sequence: | MDLQASLLSTGPNASNISDGQDNFTLAGPPPRTRSVSYINIIMPSVFGTICLLGIVGNST
VIFAVVKKSKLHWCSNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLIT
AMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSMATLVICLLWALSFISITPVWL
YARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVKILQRMTSSVA
PASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLG
YANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRTVSNAQTADEERTESKGT
|
|
|
BDBM119755 |
---|
n/a |
---|
Name | BDBM119755 |
Synonyms: | US8685958, 4 | US8685958, 5 |
Type | Small organic molecule |
Emp. Form. | C26H28N4O5 |
Mol. Mass. | 476.5243 |
SMILES | COc1ccc(cc1)-c1nnc(o1)C(=O)N1CC(C1)Oc1ccc(CN2CC3(C2)CCCO3)cc1 |
Structure |
|