| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanin-concentrating hormone receptor 1 |
|---|
| Ligand | BDBM50159141 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1566584 (CHEMBL3791478) |
|---|
| IC50 | 14±n/a nM |
|---|
| Citation |  Johansson, A; Löfberg, C; Antonsson, M; von Unge, S; Hayes, MA; Judkins, R; Ploj, K; Benthem, L; Lindén, D; Brodin, P; Wennerberg, M; Fredenwall, M; Li, L; Persson, J; Bergman, R; Pettersen, A; Gennemark, P; Hogner, A Discovery of (3-(4-(2-Oxa-6-azaspiro[3.3]heptan-6-ylmethyl)phenoxy)azetidin-1-yl)(5-(4-methoxyphenyl)-1,3,4-oxadiazol-2-yl)methanone (AZD1979), a Melanin Concentrating Hormone Receptor 1 (MCHr1) Antagonist with Favorable Physicochemical Properties. J Med Chem59:2497-511 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanin-concentrating hormone receptor 1 |
|---|
| Name: | Melanin-concentrating hormone receptor 1 |
|---|
| Synonyms: | Gpr24 | MCHR1_MOUSE | Mchr1 | Slc1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 39133.74 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_818502 |
|---|
| Residue: | 353 |
|---|
| Sequence: | MDLQASLLSTGPNASNISDGQDNFTLAGPPPRTRSVSYINIIMPSVFGTICLLGIVGNST
VIFAVVKKSKLHWCSNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLIT
AMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSMATLVICLLWALSFISITPVWL
YARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVKILQRMTSSVA
PASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLG
YANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRTVSNAQTADEERTESKGT
|
|
|
|---|
| BDBM50159141 |
|---|
| n/a |
|---|
| Name | BDBM50159141 |
|---|
| Synonyms: | CHEMBL3785343 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H28N4O4 |
|---|
| Mol. Mass. | 448.5142 |
|---|
| SMILES | CN(Cc1ccc(OC2CN(C2)C(=O)c2nnc(o2)-c2ccccc2)cc1)CC1(C)COC1 |
|---|
| Structure | 
|
|---|
Search and Browse
