Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetReceptor-interacting serine/threonine-protein kinase 1
LigandBDBM50159507
Substrate/Competitorn/a
Meas. Tech.ChEBML_1569467
IC50>10000±n/a nM
Citation Harris PAKing BWBandyopadhyay DBerger SBCampobasso NCapriotti CACox JADare LDong XFinger JNGrady LCHoffman SJJeong JUKang JKasparcova VLakdawala ASLehr RMcNulty DENagilla ROuellette MTPao CSRendina ARSchaeffer MCSummerfield JDSwift BATotoritis RDWard PZhang AZhang DMarquis RWBertin JGough PJ DNA-Encoded Library Screening Identifies Benzo[b][1,4]oxazepin-4-ones as Highly Potent and Monoselective Receptor Interacting Protein 1 Kinase Inhibitors. J Med Chem 59:2163-78 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Receptor-interacting serine/threonine-protein kinase 1
Name:Receptor-interacting serine/threonine-protein kinase 1
Synonyms:Cell death protein RIP | RIP-1 | Receptor-interacting protein 1 | Receptor-interacting serine/threonine-protein kinase 1 | Rinp | Rip | Ripk1 | Serine/threonine-protein kinase RIP
Type:PROTEIN
Mol. Mass.:74852.62
Organism:Mus musculus
Description:ChEMBL_116773
Residue:656
Sequence:
MQPDMSLDNIKMASSDLLEKTDLDSGGFGKVSLCYHRSHGFVILKKVYTGPNRAEYNEVL
LEEGKMMHRLRHSRVVKLLGIIIEEGNYSLVMEYMEKGNLMHVLKTQIDVPLSLKGRIIV
EAIEGMCYLHDKGVIHKDLKPENILVDRDFHIKIADLGVASFKTWSKLTKEKDNKQKEVS
STTKKNNGGTLYYMAPEHLNDINAKPTEKSDVYSFGIVLWAIFAKKEPYENVICTEQFVI
CIKSGNRPNVEEILEYCPREIISLMERCWQAIPEDRPTFLGIEEEFRPFYLSHFEEYVEE
DVASLKKEYPDQSPVLQRMFSLQHDCVPLPPSRSNSEQPGSLHSSQGLQMGPVEESWFSS
SPEYPQDENDRSVQAKLQEEASYHAFGIFAEKQTKPQPRQNEAYNREEERKRRVSHDPFA
QQRARENIKSAGARGHSDPSTTSRGIAVQQLSWPATQTVWNNGLYNQHGFGTTGTGVWYP
PNLSQMYSTYKTPVPETNIPGSTPTMPYFSGPVADDLIKYTIFNSSGIQIGNHNYMDVGL
NSQPPNNTCKEESTSRHQAIFDNTTSLTDEHLNPIRENLGRQWKNCARKLGFTESQIDEI
DHDYERDGLKEKVYQMLQKWLMREGTKGATVGKLAQALHQCCRIDLLNHLIRASQS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50159507
n/a
NameBDBM50159507
Synonyms:CHEMBL3785703
TypeSmall organic molecule
Emp. Form.C21H19N3O4
Mol. Mass.377.3933
SMILESCN1c2ccccc2OC[C@H](NC(=O)c2cc(Cc3ccccc3)on2)C1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: