Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRenal Outer Medullary Potassium (ROMK)
LigandBDBM162872
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1571199
IC50 60±n/a nM
Citation Walsh SPShahripour ATang Hde Jesus RKTeumelsan NZhu YFrie JPriest BTSwensen AMAlonso-Galicia MFelix JPBrochu RMBailey TThomas-Fowlkes BZhou XPai LYHampton CHernandez MOwens KEhrhart JRoy SKaczorowski GJYang LGarcia MLPasternak A Differentiation of ROMK potency from hERG potency in the phenacetyl piperazine series through heterocycle incorporation. Bioorg Med Chem Lett 26:2339-43 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Renal Outer Medullary Potassium (ROMK)
Name:Renal Outer Medullary Potassium (ROMK)
Synonyms:ATP-regulated potassium channel ROM-K | ATP-sensitive inward rectifier potassium channel 1 | Inward rectifier K(+) channel Kir1.1 | KAB-1 | Kcnj1 | Potassium channel (ATP modulatory) | Potassium channel, inwardly rectifying subfamily J member 1 | Renal Outer Medullary Potassium (ROMK1) | Romk1 | The Renal Outer Medullary Potassium (ROMK) channel (Kir1.1)
Type:Enzyme
Mol. Mass.:44976.27
Organism:Rattus norvegicus (Rat)
Description:P35560
Residue:391
Sequence:
MGASERSVFRVLIRALTERMFKHLRRWFITHIFGRSRQRARLVSKEGRCNIEFGNVDAQS
RFIFFVDIWTTVLDLKWRYKMTVFITAFLGSWFLFGLLWYVVAYVHKDLPEFYPPDNRTP
CVENINGMTSAFLFSLETQVTIGYGFRFVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTITPEGE
TIILDQTNINFVVDAGNENLFFISPLTIYHIIDHNSPFFHMAAETLSQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFVPIVSKTKEGKYRVDFHNFGKTVEVETPHCAMCLY
NEKDARARMKRGYDNPNFVLSEVDETDDTQM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM162872
n/a
NameBDBM162872
Synonyms:US9056859, 72
TypeSmall organic molecule
Emp. Form.C23H25N7O3
Mol. Mass.447.4897
SMILESCc1c2COC(=O)c2ccc1CCN1CCN(CC1)C(=O)Cc1ccc(nc1)-n1cnnn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: