Reaction Details |
| Report a problem with these data |
Target | ATP-sensitive inward rectifier potassium channel 1 |
---|
Ligand | BDBM50163355 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1571177 (CHEMBL3797008) |
---|
IC50 | 70±n/a nM |
---|
Citation | Walsh, SP; Shahripour, A; Tang, H; de Jesus, RK; Teumelsan, N; Zhu, Y; Frie, J; Priest, BT; Swensen, AM; Alonso-Galicia, M; Felix, JP; Brochu, RM; Bailey, T; Thomas-Fowlkes, B; Zhou, X; Pai, LY; Hampton, C; Hernandez, M; Owens, K; Ehrhart, J; Roy, S; Kaczorowski, GJ; Yang, L; Garcia, ML; Pasternak, A Differentiation of ROMK potency from hERG potency in the phenacetyl piperazine series through heterocycle incorporation. Bioorg Med Chem Lett26:2339-43 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
ATP-sensitive inward rectifier potassium channel 1 |
---|
Name: | ATP-sensitive inward rectifier potassium channel 1 |
Synonyms: | ATP-regulated potassium channel ROM-K | ATP-sensitive inward rectifier potassium channel 1 | Inward rectifier K(+) channel Kir1.1 | KAB-1 | KCNJ1_RAT | Kcnj1 | Potassium channel (ATP modulatory) | Potassium channel, inwardly rectifying subfamily J member 1 | Renal Outer Medullary Potassium (ROMK) | Renal Outer Medullary Potassium (ROMK1) | Romk1 | The Renal Outer Medullary Potassium (ROMK) channel (Kir1.1) |
Type: | Enzyme |
Mol. Mass.: | 44976.27 |
Organism: | Rattus norvegicus (Rat) |
Description: | P35560 |
Residue: | 391 |
Sequence: | MGASERSVFRVLIRALTERMFKHLRRWFITHIFGRSRQRARLVSKEGRCNIEFGNVDAQS
RFIFFVDIWTTVLDLKWRYKMTVFITAFLGSWFLFGLLWYVVAYVHKDLPEFYPPDNRTP
CVENINGMTSAFLFSLETQVTIGYGFRFVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTITPEGE
TIILDQTNINFVVDAGNENLFFISPLTIYHIIDHNSPFFHMAAETLSQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFVPIVSKTKEGKYRVDFHNFGKTVEVETPHCAMCLY
NEKDARARMKRGYDNPNFVLSEVDETDDTQM
|
|
|
BDBM50163355 |
---|
n/a |
---|
Name | BDBM50163355 |
Synonyms: | CHEMBL3793685 |
Type | Small organic molecule |
Emp. Form. | C24H27N7O3 |
Mol. Mass. | 461.5163 |
SMILES | Cc1nc(ccc1CC(=O)N1CCN(CCc2ccc3C(=O)OCc3c2C)CC1)-n1cnnn1 |
Structure |
|