Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetATP-sensitive inward rectifier potassium channel 1
LigandBDBM50442600
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1571175
IC50 64±n/a nM
Citation Walsh SPShahripour ATang Hde Jesus RKTeumelsan NZhu YFrie JPriest BTSwensen AMAlonso-Galicia MFelix JPBrochu RMBailey TThomas-Fowlkes BZhou XPai LYHampton CHernandez MOwens KEhrhart JRoy SKaczorowski GJYang LGarcia MLPasternak A Differentiation of ROMK potency from hERG potency in the phenacetyl piperazine series through heterocycle incorporation. Bioorg Med Chem Lett 26:2339-43 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
ATP-sensitive inward rectifier potassium channel 1
Name:ATP-sensitive inward rectifier potassium channel 1
Synonyms:Potassium channel (ATP modulatory) | Potassium inwardly-rectifying channel, subfamily J, member 1 | Renal Outer Medullary Potassium (ROMK1) | The Renal Outer Medullary Potassium (ROMK)
Type:Enzyme Catalytic Domain
Mol. Mass.:44809.08
Organism:Homo sapiens (Human)
Description:gi_223460826
Residue:391
Sequence:
MNASSRNVFDTLIRVLTESMFKHLRKWVVTRFFGHSRQRARLVSKDGRCNIEFGNVEAQS
RFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWYAVAYIHKDLPEFHPSANHTP
CVENINGLTSAFLFSLETQVTIGYGFRCVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGE
TIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLY
NEKDVRARMKRGYDNPNFILSEVNETDDTKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50442600
n/a
NameBDBM50442600
Synonyms:CHEMBL2441437 | US9056859, 1
TypeSmall organic molecule
Emp. Form.C23H24N6O3
Mol. Mass.432.4751
SMILESO=C(Cc1ccc(cc1)-n1cnnn1)N1CCN(CCc2ccc3C(=O)OCc3c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: