Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 13 (CA XIII)
LigandBDBM50163865
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1572883
Kd 0.42±n/a nM
Citation Talibov VOLinkuviene VMatulis DDanielson UH Kinetically Selective Inhibitors of Human Carbonic Anhydrase Isozymes I, II, VII, IX, XII, and XIII. J Med Chem 59:2083-93 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 13 (CA XIII)
Name:Carbonic anhydrase 13 (CA XIII)
Synonyms:Carbonic anhydrase XIII (CA XIII)
Type:Enzyme
Mol. Mass.:29445.78
Organism:Homo sapiens (Human)
Description:Q8N1Q1
Residue:262
Sequence:
MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKII
SNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELH
VVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNF
DLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAA
FLVSNHRPPQPLKGRKVRASFH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50163865
n/a
NameBDBM50163865
Synonyms:CHEMBL3799577 | carbonic anhydrase (CA) inhibitors, benzenesulphonamide ligand, 14
TypeSmall organic molecule
Emp. Form.C15H15F3N2O4S2
Mol. Mass.408.416
SMILESCNc1c(F)c(c(F)c(F)c1S(=O)(=O)CCc1ccccc1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: