Reaction Details |
| Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 1 |
---|
Ligand | BDBM50164499 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1574131 (CHEMBL3801746) |
---|
EC50 | 0.300000±n/a nM |
---|
Citation | Watterson, SH; Guo, J; Spergel, SH; Langevine, CM; Moquin, RV; Shen, DR; Yarde, M; Cvijic, ME; Banas, D; Liu, R; Suchard, SJ; Gillooly, K; Taylor, T; Rex-Rabe, S; Shuster, DJ; McIntyre, KW; Cornelius, G; D'Arienzo, C; Marino, A; Balimane, P; Warrack, B; Salter-Cid, L; McKinnon, M; Barrish, JC; Carter, PH; Pitts, WJ; Xie, J; Dyckman, AJ Potent and Selective Agonists of Sphingosine 1-Phosphate 1 (S1P1): Discovery and SAR of a Novel Isoxazole Based Series. J Med Chem59:2820-40 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 1 |
---|
Name: | Sphingosine 1-phosphate receptor 1 |
Synonyms: | CHEDG1 | EDG1 | Endothelial differentiation G-protein coupled receptor 1 | S1P receptor | S1P1 | S1PR1 | S1PR1_HUMAN | Sphingosine 1-phosphate receptor 1 (S1PR1) | Sphingosine 1-phosphate receptor Edg-1 |
Type: | Enzyme |
Mol. Mass.: | 42836.02 |
Organism: | Homo sapiens (Human) |
Description: | P21453 |
Residue: | 382 |
Sequence: | MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
|
|
|
BDBM50164499 |
---|
n/a |
---|
Name | BDBM50164499 |
Synonyms: | CHEMBL3797951 |
Type | Small organic molecule |
Emp. Form. | C23H28N4O4 |
Mol. Mass. | 424.4928 |
SMILES | CCCc1c(CC(C)C)onc1-c1nc(no1)-c1ccc(CN2CC(C2)C(O)=O)cc1 |
Structure |
|