| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Growth hormone secretagogue receptor type 1 |
|---|
| Ligand | BDBM50165588 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1574213 (CHEMBL3802218) |
|---|
| Temperature | 298.15±n/a K |
|---|
| Ki | 3.0±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Maingot, M; Blayo, AL; Denoyelle, S; M'Kadmi, C; Damian, M; Mary, S; Gagne, D; Sanchez, P; Aicher, B; Schmidt, P; Müller, G; Teifel, M; Günther, E; Marie, J; Banères, JL; Martinez, J; Fehrentz, JA New ligands of the ghrelin receptor based on the 1,2,4-triazole scaffold by introduction of a second chiral center. Bioorg Med Chem Lett26:2408-12 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Growth hormone secretagogue receptor type 1 |
|---|
| Name: | Growth hormone secretagogue receptor type 1 |
|---|
| Synonyms: | GH-releasing peptide receptor | GHRP | GHS-R | GHSR | GHSR_HUMAN | Ghrelin Receptor (Growth Hormone Secretagogue Receptor Type 1) | Ghrelin receptor | Ghrelin receptor 1a (GHS-R1a) |
|---|
| Type: | Receptor |
|---|
| Mol. Mass.: | 41334.57 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Receptor binding studies use plasma membranes from LLC PK-1 cells transiently transfected with hGHSR1a. |
|---|
| Residue: | 366 |
|---|
| Sequence: | MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
|
|
|
|---|
| BDBM50165588 |
|---|
| n/a |
|---|
| Name | BDBM50165588 |
|---|
| Synonyms: | CHEMBL3800422 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C48H61N9O6 |
|---|
| Mol. Mass. | 860.0546 |
|---|
| SMILES | COc1ccc(Cn2c(nnc2[C@@H](Cc2c[nH]c3ccccc23)NC(=O)C(C)(C)O)[C@@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(C)=O)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
