Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificty protein kinase CLK1
LigandBDBM50166588
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1572584
IC50>10±n/a nM
Citation Katoh TTakai TYukawa TTsukamoto TWatanabe EMototani HArita THayashi HNakagawa HKlein MGZou HSang BCSnell GNakada Y Discovery and optimization of 1,7-disubstituted-2,2-dimethyl-2,3-dihydroquinazolin-4(1H)-ones as potent and selective PKC┐ inhibitors. Bioorg Med Chem 24:2466-75 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual specificty protein kinase CLK1
Name:Dual specificity protein kinase CLK1/CLK4
Synonyms:CDC-like kinase 1 | CDC-like kinase 1 (CLK1) | CDC2-like kinase 1 (CLK1) | Dual specificity protein kinase CLK1
Type:Protein
Mol. Mass.:57322.21
Organism:Homo sapiens (Human)
Description:P49759
Residue:484
Sequence:
MRHSKRTYCPDWDDKDWDYGKWRSSSSHKRRKRSHSSAQENKRCKYNHSKMCDSHYLESR
SINEKDYHSRRYIDEYRNDYTQGCEPGHRQRDHESRYQNHSSKSSGRSGRSSYKSKHRIH
HSTSHRRSHGKSHRRKRTRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECID
HKAGGRHVAVKIVKNVDRYCEAARSEIQVLEHLNTTDPNSTFRCVQMLEWFEHHGHICIV
FELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVQSD
YTEAYNPKIKRDERTLINPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPC
DVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPKHMIQKTRKRKYFHHDRLDWD
EHSSAGRYVSRRCKPLKEFMLSQDVEHERLFDLIQKMLEYDPAKRITLREALKHPFFDLL
KKSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50166588
n/a
NameBDBM50166588
Synonyms:CHEMBL3798011
TypeSmall organic molecule
Emp. Form.C24H23N5O2
Mol. Mass.413.4717
SMILESC[C@@H](N1c2cc(ccc2C(=O)NC1(C)C)-n1c2cccnc2[nH]c1=O)c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: