Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(2) dopamine receptor
LigandBDBM50054067
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1573522
Ki 40±n/a nM
Citation Weichert DStanek MHübner HGmeiner P Structure-guided development of dualß2 adrenergic/dopamine D2 receptor agonists. Bioorg Med Chem 24:2641-53 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(2) dopamine receptor
Name:D(2) dopamine receptor/Metabotropic glutamate receptor 5
Synonyms:DOPAMINE D2 | DOPAMINE D2 Long | DOPAMINE D2 Short | DRD2 | Dopamine D2 receptor | Dopamine D2 receptor (D2) | Dopamine D2 receptor (D2R) | Dopamine D2A | Dopamine2-like
Type:Cell-surface receptors
Mol. Mass.:50647.10
Organism:Homo sapiens (Human)
Description:P14416
Residue:443
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50054067
n/a
NameBDBM50054067
Synonyms:(2R)-7-Dipropylamino-5,6,7,8-tetrahydro-naphthalen-2-ol | (7-Hydroxy-1,2,3,4-tetrahydro-naphthalen-2-yl)-dipropyl-ammonium(R(+)7OH-DPAT) | (R)-7-(dipropylamino)-5,6,7,8-tetrahydronaphthalen-2-ol | (R)-7-Dipropylamino-5,6,7,8-tetrahydro-naphthalen-2-ol | (R)-7-Dipropylamino-5,6,7,8-tetrahydro-naphthalen-2-ol.HCl | 7-Dipropylamino-5,6,7,8-tetrahydro-naphthalen-2-ol | CHEMBL301559
TypeSmall organic molecule
Emp. Form.C16H25NO
Mol. Mass.247.3758
SMILESCCCN(CCC)[C@@H]1CCc2ccc(O)cc2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: