Reaction Details |
| Report a problem with these data |
Target | Macrophage migration inhibitory factor |
---|
Ligand | BDBM92515 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1574570 (CHEMBL3804642) |
---|
IC50 | 570±n/a nM |
---|
Citation | Cisneros, JA; Robertson, MJ; Valhondo, M; Jorgensen, WL Irregularities in enzyme assays: The case of macrophage migration inhibitory factor. Bioorg Med Chem Lett26:2764-2767 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Macrophage migration inhibitory factor |
---|
Name: | Macrophage migration inhibitory factor |
Synonyms: | GIF | GLIF | Glycosylation-inhibiting factor | L-dopachrome isomerase | L-dopachrome tautomerase | MIF | MIF/CD74 (Macrophage migration inhibitory factor and HLA-DR antigens-associated invariant chain) | MIF_HUMAN | MMIF | Macrophage migration inhibitory factor | Macrophage migration inhibitory factor (MIF) | Phenylpyruvate tautomerase |
Type: | Enzyme |
Mol. Mass.: | 12478.18 |
Organism: | Homo sapiens (Human) |
Description: | P14174 |
Residue: | 115 |
Sequence: | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
|
BDBM92515 |
---|
n/a |
---|
Name | BDBM92515 |
Synonyms: | RDR 03785, 11 |
Type | Small organic molecule |
Emp. Form. | C19H18F3NO4 |
Mol. Mass. | 381.3457 |
SMILES | Oc1cc2OCOc2cc1C(N1CCOCC1)c1ccc(cc1)C(F)(F)F |
Structure |
|