| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 5 |
|---|
| Ligand | BDBM50169441 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1578115 (CHEMBL3807070) |
|---|
| EC50 | 11±n/a nM |
|---|
| Citation |  Dhar, TG; Xiao, HY; Xie, J; Lehman-McKeeman, LD; Wu, DR; Dabros, M; Yang, X; Taylor, TL; Zhou, XD; Heimrich, EM; Thomas, R; McIntyre, KW; Warrack, B; Shi, H; Levesque, PC; Zhu, JL; Hennan, J; Balimane, P; Yang, Z; Marino, AM; Cornelius, G; D'Arienzo, CJ; Mathur, A; Shen, DR; Cvijic, ME; Salter-Cid, L; Barrish, JC; Carter, PH; Dyckman, AJ Identification and Preclinical Pharmacology of BMS-986104: A Differentiated S1P1 Receptor Modulator in Clinical Trials. ACS Med Chem Lett7:283-8 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 5 |
|---|
| Name: | Sphingosine 1-phosphate receptor 5 |
|---|
| Synonyms: | EDG8 | Endothelial differentiation sphingolipid G-protein-coupled receptor 8 | S1P5 | S1PR5 | S1PR5_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-8 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 41796.42 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 398 |
|---|
| Sequence: | MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFIVLENLAVLLV
LGRHPRFHAPMFLLLGSLTLSDLLAGAAYAANILLSGPLTLKLSPALWFAREGGVFVALT
ASVLSLLAIALERSLTMARRGPAPVSSRGRTLAMAAAAWGVSLLLGLLPALGWNCLGRLD
ACSTVLPLYAKAYVLFCVLAFVGILAAICALYARIYCQVRANARRLPARPGTAGTTSTRA
RRKPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPARTCPVLLQADPFLGLAMANSL
LNPIIYTLTNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRRCLPPGLDGSF
SGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEPAAD
|
|
|
|---|
| BDBM50169441 |
|---|
| n/a |
|---|
| Name | BDBM50169441 |
|---|
| Synonyms: | CHEMBL3806205 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H36NO4P |
|---|
| Mol. Mass. | 409.4993 |
|---|
| SMILES | CCCCCC[C@@H]1CCc2cc(ccc2C1)[C@H]1CC[C@](N)(COP(O)(O)=O)C1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
