Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 121
LigandBDBM31772
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1576820
Kd 73±n/a nM
Citation Kavanagh MECoyne AGMcLean KJJames GGLevy CWMarino LBde Carvalho LPChan DSHudson SASurade SLeys DMunro AWAbell C Fragment-Based Approaches to the Development of Mycobacterium tuberculosis CYP121 Inhibitors. J Med Chem 59:3272-302 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 121
Name:Cytochrome P450 121
Synonyms:Cytochrome P450 MT2
Type:PROTEIN
Mol. Mass.:43255.98
Organism:Mycobacterium tuberculosis
Description:ChEMBL_721243
Residue:396
Sequence:
MTATVLLEVPFSARGDRIPDAVAELRTREPIRKVRTITGAEAWLVSSYALCTQVLEDRRF
SMKETAAAGAPRLNALTVPPEVVNNMGNIADAGLRKAVMKAITPKAPGLEQFLRDTANSL
LDNLITEGAPADLRNDFADPLATALHCKVLGIPQEDGPKLFRSLSIAFMSSADPIPAAKI
NWDRDIEYMAGILENPNITTGLMGELSRLRKDPAYSHVSDELFATIGVTFFGAGVISTGS
FLTTALISLIQRPQLRNLLHEKPELIPAGVEELLRINLSFADGLPRLATADIQVGDVLVR
KGELVLVLLEGANFDPEHFPNPGSIELDRPNPTSHLAFGRGQHFCPGSALGRRHAQIGIE
ALLKKMPGVDLAVPIDQLVWRTRFQRRIPERLPVLW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31772
n/a
NameBDBM31772
Synonyms:1-[2-(2,4-dichlorobenzyl)oxy-2-(2,4-dichlorophenyl)ethyl]imidazole;nitric acid | Brentan | CHEMBL91 | Dactarin | Miconazole | US9138393, Miconazole Nitrate | US9144538, Miconazole Nitrate | cid_4189
TypeSmall organic molecule
Emp. Form.C18H14Cl4N2O
Mol. Mass.416.129
SMILESClc1ccc(COC(Cn2ccnc2)c2ccc(Cl)cc2Cl)c(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: