Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD-Amino Acid Oxidase (DAAO)
LigandBDBM31148
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1577591
IC50 94±n/a nM
Citation Xie DLu JXie JCui JLi TFWang YCChen YGong NLi XYFu LWang YX Discovery and analgesic evaluation of 8-chloro-1,4-dihydropyrido[2,3-b]pyrazine-2,3-dione as a novel potent d-amino acid oxidase inhibitor. Eur J Med Chem 117:19-32 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
D-Amino Acid Oxidase (DAAO)
Name:D-Amino Acid Oxidase (DAAO)
Synonyms:DAMOX | DAO
Type:Homodimer
Mol. Mass.:38824.91
Organism:Rattus norvegicus (rat)
Description:Recombinant rat DAAO expressed and purified from sf9 insect cells, was used in enzyme assays.
Residue:346
Sequence:
MRVAVIGAGVIGLSTALCIHERYHPAQPLHMKIYADRFTPFTTSDVAAGLWQPYLSDPSN
PQEAEWNQQTFDHLQSCLHSPNAEKMGLALISGYNLFRDEVPDPFWKSTVLGFRKLTPSE
LDMFPDYSYGWFNTSLLLEGKSYLSWLTERLTERGVKFIHRKVASFEEVVRGGVDVIINC
TGVWAGALQADASLQPGRGQIIQVEAPWIKHFILTHDPSLGIYNSPYIIPGSKTVTLGGV
FQLGNWSELNSVHDHNTIWKSCCQLEPTLKNARIMGELTGFRPVRPQVRLERERLRFGSS
SAEVIHNYGHGGYGLTIHWGCAMEAANLFGKILEEKNLSRMPPSHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31148
n/a
NameBDBM31148
Synonyms:3-hydroxyquinolin-2(1H)-one, 2 | US9701638, 1
TypeSmall organic molecule
Emp. Form.C9H7NO2
Mol. Mass.161.1574
SMILESOc1cc2ccccc2[nH]c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: