Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeucine aminopeptidase (LAP)
LigandBDBM50170883
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1577950
Ki 23800±n/a nM
Citation Weglarz-Tomczak EBerlicki LPawelczak MNocek BJoachimiak AMucha A A structural insight into the P1S1 binding mode of diaminoethylphosphonic and phosphinic acids, selective inhibitors of alanine aminopeptidases. Eur J Med Chem 117:187-96 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Leucine aminopeptidase (LAP)
Name:Leucine aminopeptidase (LAP)
Synonyms:Cytosol aminopeptidase
Type:Enzyme
Mol. Mass.:4015.44
Organism:Sus scrofa (Pig)
Description:P28839
Residue:36
Sequence:
TKGLVLGIYSKEKEDDAPQFTSAGENFDKWVSGKLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50170883
n/a
NameBDBM50170883
Synonyms:CHEMBL3805118
TypeSmall organic molecule
Emp. Form.C19H31N2O4P
Mol. Mass.382.4342
SMILESNC(CNC1CCCCCC1)P(O)(=O)CC(Cc1ccccc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: