Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAminopeptidase N
LigandBDBM50170883
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1577952
Ki 3240±n/a nM
Citation Weglarz-Tomczak EBerlicki LPawelczak MNocek BJoachimiak AMucha A A structural insight into the P1S1 binding mode of diaminoethylphosphonic and phosphinic acids, selective inhibitors of alanine aminopeptidases. Eur J Med Chem 117:187-96 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Aminopeptidase N
Name:Aminopeptidase N
Synonyms:ANPEP | AP-M | AP-N | Alanyl aminopeptidase | Aminopeptidase M | Aminopeptidase N (APN) | CD_antigen=CD13 | Microsomal aminopeptidase | gp130 | pAPN
Type:Protein
Mol. Mass.:108810.25
Organism:Sus scrofa (Pig)
Description:P15145
Residue:963
Sequence:
MAKGFYISKALGILGILLGVAAVATIIALSVVYAQEKNKNAEHVPQAPTSPTITTTAAIT
LDQSKPWNRYRLPTTLLPDSYNVTLRPYLTPNADGLYIFKGKSIVRLLCQEPTDVIIIHS
KKLNYTTQGHMVVLRGVGDSQVPEIDRTELVELTEYLVVHLKGSLQPGHMYEMESEFQGE
LADDLAGFYRSEYMEGNVKKVLATTQMQSTDARKSFPCFDEPAMKATFNITLIHPNNLTA
LSNMPPKGSSTPLAEDPNWSVTEFETTPVMSTYLLAYIVSEFQSVNETAQNGVLIRIWAR
PNAIAEGHGMYALNVTGPILNFFANHYNTSYPLPKSDQIALPDFNAGAMENWGLVTYREN
ALLFDPQSSSISNKERVVTVIAHELAHQWFGNLVTLAWWNDLWLNEGFASYVEYLGADHA
EPTWNLKDLIVPGDVYRVMAVDALASSHPLTTPAEEVNTPAQISEMFDSISYSKGASVIR
MLSNFLTEDLFKEGLASYLHAFAYQNTTYLDLWEHLQKAVDAQTSIRLPDTVRAIMDRWT
LQMGFPVITVDTKTGNISQKHFLLDSESNVTRSSAFDYLWIVPISSIKNGVMQDHYWLRD
VSQAQNDLFKTASDDWVLLNVNVTGYFQVNYDEDNWRMIQHQLQTNLSVIPVINRAQVIY
DSFNLATAHMVPVTLALDNTLFLNGEKEYMPWQAALSSLSYFSLMFDRSEVYGPMKKYLR
KQVEPLFQHFETLTKNWTERPENLMDQYSEINAISTACSNGLPQCENLAKTLFDQWMSDP
ENNPIHPNLRSTIYCNAIAQGGQDQWDFAWGQLQQAQLVNEADKLRSALACSNEVWLLNR
YLGYTLNPDLIRKQDATSTINSIASNVIGQPLAWDFVQSNWKKLFQDYGGGSFSFSNLIQ
GVTRRFSSEFELQQLEQFKKNNMDVGFGSGTRALEQALEKTKANIKWVKENKEVVLNWFI
EHS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50170883
n/a
NameBDBM50170883
Synonyms:CHEMBL3805118
TypeSmall organic molecule
Emp. Form.C19H31N2O4P
Mol. Mass.382.4342
SMILESNC(CNC1CCCCCC1)P(O)(=O)CC(Cc1ccccc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: