Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAminopeptidase N
LigandBDBM50170896
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1577953
Ki 13500±n/a nM
Citation Weglarz-Tomczak EBerlicki LPawelczak MNocek BJoachimiak AMucha A A structural insight into the P1S1 binding mode of diaminoethylphosphonic and phosphinic acids, selective inhibitors of alanine aminopeptidases. Eur J Med Chem 117:187-96 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Aminopeptidase N
Name:Aminopeptidase
Synonyms:Alanyl aminopeptidase | CD_antigen=CD13 | Microsomal aminopeptidase | Myeloid plasma membrane glycoprotein CD13 | gp150 | hAPN
Type:PROTEIN
Mol. Mass.:109522.63
Organism:Homo sapiens (Human)
Description:ChEMBL_1507526
Residue:967
Sequence:
MAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNANSSPVASTTPSASATTNPA
SATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVI
IIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDS
EFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIHP
KDLTALSNMLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLLAFIVSEFDYVEKQASNGVLI
RIWARPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQIGLPDFNAGAMENWGLV
TYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYL
GADYAEPTWNLKDLMVLNDVYRVMAVDALASSHPLSTPASEINTPAQISELFDAISYSKG
ASVLRMLSSFLSEDVFKQGLASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVRDIM
NRWTLQMGFPVITVDTSTGTLSQEHFLLDPDSNVTRPSEFNYVWIVPITSIRDGRQQQDY
WLIDVRAQNDLFSTSGNEWVLLNLNVTGYYRVNYDEENWRKIQTQLQRDHSAIPVINRAQ
IINDAFNLASAHKVPVTLALNNTLFLIEERQYMPWEAALSSLSYFKLMFDRSEVYGPMKN
YLKKQVTPLFIHFRNNTNNWREIPENLMDQYSEVNAISTACSNGVPECEEMVSGLFKQWM
ENPNNNPIHPNLRSTVYCNAIAQGGEEEWDFAWEQFRNATLVNEADKLRAALACSKELWI
LNRYLSYTLNPDLIRKQDATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSN
LIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQ
WFTENSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50170896
n/a
NameBDBM50170896
Synonyms:CHEMBL3805251
TypeSmall organic molecule
Emp. Form.C8H20N3O3P
Mol. Mass.237.2365
SMILESNC(CNC1CCCCC1N)P(O)(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: