Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeucine aminopeptidase (LAP)
LigandBDBM50170900
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1577950
Ki 119000±n/a nM
Citation Weglarz-Tomczak EBerlicki LPawelczak MNocek BJoachimiak AMucha A A structural insight into the P1S1 binding mode of diaminoethylphosphonic and phosphinic acids, selective inhibitors of alanine aminopeptidases. Eur J Med Chem 117:187-96 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Leucine aminopeptidase (LAP)
Name:Leucine aminopeptidase (LAP)
Synonyms:Cytosol aminopeptidase
Type:Enzyme
Mol. Mass.:4015.44
Organism:Sus scrofa (Pig)
Description:P28839
Residue:36
Sequence:
TKGLVLGIYSKEKEDDAPQFTSAGENFDKWVSGKLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50170900
n/a
NameBDBM50170900
Synonyms:CHEMBL3806247
TypeSmall organic molecule
Emp. Form.C8H21N2O3P
Mol. Mass.224.2377
SMILESCCCCCCNCC(N)P(O)(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: