Reaction Details |
| Report a problem with these data |
Target | Cytosol aminopeptidase [33-68,L62W] |
---|
Ligand | BDBM50170896 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1577950 (CHEMBL3806574) |
---|
Ki | 240000±n/a nM |
---|
Citation | Weglarz-Tomczak, E; Berlicki, L; Pawelczak, M; Nocek, B; Joachimiak, A; Mucha, A A structural insight into the P1S1 binding mode of diaminoethylphosphonic and phosphinic acids, selective inhibitors of alanine aminopeptidases. Eur J Med Chem117:187-96 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cytosol aminopeptidase [33-68,L62W] |
---|
Name: | Cytosol aminopeptidase [33-68,L62W] |
Synonyms: | AMPL_PIG | Cytosol aminopeptidase | LAP3 | Leucine aminopeptidase (LAP) |
Type: | Enzyme |
Mol. Mass.: | 4015.44 |
Organism: | Sus scrofa (Pig) |
Description: | P28839[33-68,L62W] |
Residue: | 36 |
Sequence: | TKGLVLGIYSKEKEDDAPQFTSAGENFDKWVSGKLR
|
|
|
BDBM50170896 |
---|
n/a |
---|
Name | BDBM50170896 |
Synonyms: | CHEMBL3805251 |
Type | Small organic molecule |
Emp. Form. | C8H20N3O3P |
Mol. Mass. | 237.2365 |
SMILES | NC(CNC1CCCCC1N)P(O)(O)=O |
Structure |
|