Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIntegrase
LigandBDBM50170912
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1578163
IC50 660±n/a nM
Citation Billamboz MSuchaud VBailly FLion CAndréola MLChrist FDebyser ZCotelle P 2-hydroxyisoquinoline-1,3(2H,4H)-diones (HIDs) as human immunodeficiency virus type 1 integrase inhibitors: Influence of the alkylcarboxamide substitution of position 4. Eur J Med Chem 117:256-68 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Integrase
Name:Integrase
Synonyms:Integrase
Type:PROTEIN
Mol. Mass.:32203.43
Organism:Human immunodeficiency virus 1
Description:ChEMBL_106649
Residue:288
Sequence:
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50170912
n/a
NameBDBM50170912
Synonyms:CHEMBL3805930
TypeSmall organic molecule
Emp. Form.C14H16N2O4
Mol. Mass.276.2878
SMILESCCCCNC(=O)C1C(=O)N(O)C(=O)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: