Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdrenergic alpha1B
LigandBDBM50160154
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1579181
IC50 541±n/a nM
Citation Zhao FLi JChen YTian YWu CXie YZhou YWang JXie XLiu H Design, Synthesis, and Biological Evaluation of Indoline and Indole Derivatives as Potent and Selectivea1A-Adrenoceptor Antagonists. J Med Chem 59:3826-39 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adrenergic alpha1B
Name:Adrenergic receptor alpha
Synonyms:Alpha 1B-adrenoceptor | Alpha 1B-adrenoreceptor | Alpha-1B adrenergic receptor
Type:Enzyme
Mol. Mass.:56862.13
Organism:Homo sapiens (Human)
Description:P35368
Residue:520
Sequence:
MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFV
RILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRT
LPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLT
EPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50160154
n/a
NameBDBM50160154
Synonyms:1-(3-Hydroxy-propyl)-5-((R)-2-{2-[2-(2,2,2-trifluoro-ethoxy)-phenoxy]-ethylamino}-propyl)-2,3-dihydro-1H-indole-7-carboxylic acid amide | CHEMBL24778 | SILODOSIN
TypeSmall organic molecule
Emp. Form.C25H32F3N3O4
Mol. Mass.495.5345
SMILESC[C@H](Cc1cc2CCN(CCCO)c2c(c1)C(N)=O)NCCOc1ccccc1OCC(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: