Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50173129 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1579566 (CHEMBL3811076) |
---|
IC50 | 5.5±n/a nM |
---|
Citation | Guillemyn, K; Starnowska, J; Lagard, C; Dyniewicz, J; Rojewska, E; Mika, J; Chung, NN; Utard, V; Kosson, P; Lipkowski, AW; Chevillard, L; Arranz-Gibert, P; Teixidó, M; Megarbane, B; Tourwé, D; Simonin, F; Przewlocka, B; Schiller, PW; Ballet, S Bifunctional Peptide-Based Opioid Agonist-Nociceptin Antagonist Ligands for Dual Treatment of Acute and Neuropathic Pain. J Med Chem59:3777-92 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50173129 |
---|
n/a |
---|
Name | BDBM50173129 |
Synonyms: | CHEMBL3810104 |
Type | Small organic molecule |
Emp. Form. | C79H110N24O13 |
Mol. Mass. | 1603.8717 |
SMILES | Cc1cc(O)cc(C)c1C[C@H](N)C(=O)N[C@H](CCCNC(N)=N)C(=O)N[C@H]1Cc2ccccc2CN(CCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc2ccc(O)cc2)C(=O)N[C@@H](Cc2c(C)cc(O)cc2C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc2c[nH]c3ccccc23)C(=O)N[C@@H](CCCNC(N)=N)C(N)=O)C1=O |r| |
Structure |
|