Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRhodopsin kinase
LigandBDBM22416
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1581284
IC50>100000±n/a nM
Citation Waldschmidt HVHoman KTCruz-Rodríguez OCato MCWaninger-Saroni JLarimore KMCannavo ASong JCheung JYKirchhoff PDKoch WJTesmer JJLarsen SD Structure-Based Design, Synthesis, and Biological Evaluation of Highly Selective and Potent G Protein-Coupled Receptor Kinase 2 Inhibitors. J Med Chem 59:3793-807 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Rhodopsin kinase
Name:Rhodopsin kinase
Synonyms:G protein-coupled receptor kinase 1 | GRK1 | PK | RHOK
Type:PROTEIN
Mol. Mass.:63520.09
Organism:Homo sapiens (Human)
Description:ChEMBL_774378
Residue:563
Sequence:
MDFGSLETVVANSAFIAARGSFDGSSSQPSRDKKYLAKLKLPPLSKCESLRDSLSLEFES
VCLEQPIGKKLFQQFLQSAEKHLPALELWKDIEDYDTADNDLQPQKAQTILAQYLDPQAK
LFCSFLDEGIVAKFKEGPVEIQDGLFQPLLQATLAHLGQAPFQEYLGSLYFLRFLQWKWL
EAQPMGEDWFLDFRVLGKGGFGEVSACQMKATGKLYACKKLNKKRLKKRKGYQGAMVEKK
ILMKVHSRFIVSLAYAFETKADLCLVMTIMNGGDIRYHIYNVNEENPGFPEPRALFYTAQ
IICGLEHLHQRRIVYRDLKPENVLLDNDGNVRISDLGLAVELLDGQSKTKGYAGTPGFMA
PELLQGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKHRIISEPVKYPDKFS
QASKDFCEALLEKDPEKRLGFRDETCDKLRAHPLFKDLNWRQLEAGMLMPPFIPDSKTVY
AKDIQDVGAFSTVKGVAFDKTDTEFFQEFATGNCPIPWQEEMIETGIFGELNVWRSDGQM
PDDMKGISGGSSSSSKSGMCLVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22416
n/a
NameBDBM22416
Synonyms:(3S,4R)-3-[(1,3-benzodioxol-5-yloxy)methyl]-4-(4-fluorophenyl)piperidine | (3S,4R)-3-[(2H-1,3-benzodioxol-5-yloxy)methyl]-4-(4-fluorophenyl)piperidine | CHEMBL490 | PAROXETINE | [3H]Paroxetine
Typeradiolabeled ligand
Emp. Form.C19H20FNO3
Mol. Mass.329.3654
SMILESFc1ccc(cc1)[C@@H]1CCNC[C@H]1COc1ccc2OCOc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: