Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDNA topoisomerase 4 subunit B (parE)
LigandBDBM50173879
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1580966
IC50 183±n/a nM
Citation Cross JBZhang JYang QMesleh MFRomero JAWang BBevan DPoutsiaka KMEpie FMoy TDaniel AShotwell JChamberlain BCarter NAndersen OBarker JRyan MDMetcalf CASilverman JNguyen KLippa BDolle RE Discovery of Pyrazolopyridones as a Novel Class of Gyrase B Inhibitors Using Structure Guided Design. ACS Med Chem Lett 7:374-8 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
DNA topoisomerase 4 subunit B (parE)
Name:DNA topoisomerase 4 subunit B (parE)
Synonyms:DNA topoisomerase 4 subunit B | Topoisomerase IV subunit B | grlB
Type:Enzyme
Mol. Mass.:74365.92
Organism:Staphylococcus aureus
Description:Q2FYS5
Residue:663
Sequence:
MNKQNNYSDDSIQVLEGLEAVRKRPGMYIGSTDKRGLHHLVYEIVDNSVDEVLNGYGNEI
DVTINKDGSISIEDNGRGMPTGIHKSGKPTVEVIFTVLHAGGKFGQGGYKTSGGLHGVGA
SVVNALSEWLEVEIHRDGNIYHQSFKNGGSPSSGLVKKGKTKKTGTKVTFKPDDTIFKAS
TSFNFDVLSERLQESAFLLKNLKITLNDLRSGKERQEHYHYEEGIKEFVSYVNEGKEVLH
DVATFSGEANGIEVDVAFQYNDQYSESILSFVNNVRTKDGGTHEVGFKTAMTRVFNDYAR
RINELKTKDKNLDGNDIREGLTAVVSVRIPEELLQFEGQTKSKLGTSEARSAVDSVVADK
LPFYLEEKGQLSKSLVKKAIKAQQAREAARKAREDARSGKKNKRKDTLLSGKLTPAQSKN
TEKNELYLVEGDSAGGSAKLGRDRKFQAILPLRGKVINTEKARLEDIFKNEEINTIIHTI
GAGVGTDFKIEDSNYNRVIIMTDADTDGAHIQVLLLTFFFKYMKPLVQAGRVFIALPPLY
KLEKGKGKTKRVEYAWTDEELNKLQKELGKGFTLQRYKGLGEMNPEQLWETTMNPETRTL
IRVQVEDEVRSSKRVTTLMGDKVQPRREWIEKHVEFGMQEDQSILDNSEVQVLENDQFDE
EEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50173879
n/a
NameBDBM50173879
Synonyms:CHEMBL3810359
TypeSmall organic molecule
Emp. Form.C17H15N5OS
Mol. Mass.337.399
SMILESCCCn1c2[nH]nc(-c3cnc(s3)-c3cccnc3)c2ccc1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: