Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLiver X receptor (LXR alpha AND LXR beta)
LigandBDBM50177016
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1582622
Ki 3.0±n/a nM
Citation Zheng YZhuang LFan KYTice CMZhao WDong CLotesta SDLeftheris KLindblom PRLiu ZShimada JNoto PBMeng SHardy AHoward LKrosky PGuo JLipinski KKandpal GBukhtiyarov YZhao YLala DVan Orden RZhou JChen GWu ZMcKeever BMMcGeehan GMGregg REClaremon DASingh SB Discovery of a Novel, Orally Efficacious Liver X Receptor (LXR) Agonist. J Med Chem 59:3264-71 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Liver X receptor (LXR alpha AND LXR beta)
Name:Liver X receptor (LXR alpha AND LXR beta)
Synonyms:Liver X Receptor alpha (LXR-alpha) | Liver X receptor alpha | Liver X receptor alpha (LXRA) | Liver X receptor alpha (NR1H3) | Liver X, LXR alpha | Nuclear orphan receptor LXR-alpha | Nuclear receptor subfamily 1 group H member 3 | Oxysterols receptor LXR-alpha
Type:Receptor
Mol. Mass.:50403.85
Organism:Homo sapiens (Human)
Description:His-tagged hLXR.
Residue:447
Sequence:
MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEA
AEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG
FFRRSVIKGAHYICHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLK
RQEEEQAHATSLPPRASSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPM
APDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLL
ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI
AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVHE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50177016
n/a
NameBDBM50177016
Synonyms:CHEMBL3814501
TypeSmall organic molecule
Emp. Form.C19H21ClF4N4O2S
Mol. Mass.480.907
SMILESCC(C)[C@@H]1CN(CCN1c1ncc(Cl)c(n1)C(F)(F)F)c1ccc(F)c(c1)S(C)(=O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: