Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEctonucleotide pyrophosphatase/phosphodiesterase family member 1
LigandBDBM50179371
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1583537
Ki 981±n/a nM
Citation Lee SYPerotti ADe Jonghe SHerdewijn PHanck TMüller CE Thiazolo[3,2-a]benzimidazol-3(2H)-one derivatives: Structure-activity relationships of selective nucleotide pyrophosphatase/phosphodiesterase1 (NPP1) inhibitors. Bioorg Med Chem 24:3157-65 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
Name:Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:104934.43
Organism:Homo sapiens (Human)
Description:ChEMBL_1448940
Residue:925
Sequence:
MERDGCAGGGSRGGEGGRAPREGPAGNGRDRGRSHAAEAPGDPQAAASLLAPMDVGEEPL
EKAARARTAKDPNTYKVLSLVLSVCVLTTILGCIFGLKPSCAKEVKSCKGRCFERTFGNC
RCDAACVELGNCCLDYQETCIEPEHIWTCNKFRCGEKRLTRSLCACSDDCKDKGDCCINY
SSVCQGEKSWVEEPCESINEPQCPAGFETPPTLLFSLDGFRAEYLHTWGGLLPVISKLKK
CGTYTKNMRPVYPTKTFPNHYSIVTGLYPESHGIIDNKMYDPKMNASFSLKSKEKFNPEW
YKGEPIWVTAKYQGLKSGTFFWPGSDVEINGIFPDIYKMYNGSVPFEERILAVLQWLQLP
KDERPHFYTLYLEEPDSSGHSYGPVSSEVIKALQRVDGMVGMLMDGLKELNLHRCLNLIL
ISDHGMEQGSCKKYIYLNKYLGDVKNIKVIYGPAARLRPSDVPDKYYSFNYEGIARNLSC
REPNQHFKPYLKHFLPKRLHFAKSDRIEPLTFYLDPQWQLALNPSERKYCGSGFHGSDNV
FSNMQALFVGYGPGFKHGIEADTFENIEVYNLMCDLLNLTPAPNNGTHGSLNHLLKNPVY
TPKHPKEVHPLVQCPFTRNPRDNLGCSCNPSILPIEDFQTQFNLTVAEEKIIKHETLPYG
RPRVLQKENTICLLSQHQFMSGYSQDILMPLWTSYTVDRNDSFSTEDFSNCLYQDFRIPL
SPVHKCSFYKNNTKVSYGFLSPPQLNKNSSGIYSEALLTTNIVPMYQSFQVIWRYFHDTL
LRKYAEERNGVNVVSGPVFDFDYDGRCDSLENLRQKRRVIRNQEILIPTHFFIVLTSCKD
TSQTPLHCENLDTLAFILPHRTDNSESCVHGKHDSSWVEELLMLHRARITDVEHITGLSF
YQQRKEPVSDILKLKTHLPTFSQED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50179371
n/a
NameBDBM50179371
Synonyms:CHEMBL2006050
TypeSmall organic molecule
Emp. Form.C14H8N2O2S
Mol. Mass.268.291
SMILESO=c1n2c(nc3ccccc23)s\c1=C/c1ccco1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: