Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetImidazoline I1
LigandBDBM50021809
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1583797
Ki 0.794328±n/a nM
Citation Vucicevic JSrdic-Rajic TPieroni MLaurila JMPerovic VTassini SAzzali ECostantino GGlisic SAgbaba DScheinin MNikolic KRadi MVeljkovic N A combined ligand- and structure-based approach for the identification of rilmenidine-derived compounds which synergize the antitumor effects of doxorubicin. Bioorg Med Chem 24:3174-83 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Imidazoline I1
Name:Imidazoline I1
Synonyms:Nischarin
Type:Enzyme Catalytic Domain
Mol. Mass.:166460.59
Organism:RAT
Description:Q4G017
Residue:1502
Sequence:
MAAATLSFGPEREAEPAKEARVVGSELVDTYTVYVIQVTDGNHEWTIKHRYSDFHDLHEK
LVAERKIDKTLLPPKKIIGKNSRSLVEKREKDLEVYLQTLLKTFPDVAPRVLAHFLHFHL
YEINGVTAALAEELFEKGEQLLGAGEVFAIRPLQLYAITEQLQQGKPTCASGDAKTDLGH
ILDFTCRLKYLKVSGTEGPFGTSNIREQLLPFDLSIFKSLHQVEMSHCDAKHVRGLVTSK
PTLATMSVRFSAASMKEVLVPEASEFDEWEPEGTTLGGPVTAVIPTWQALTTLDLSHNSI
SEIDESVKLIPKIEYLDLSHNGVLVVDNLQHLYNLVHLDLSYNKLSSLEGVHTKLGNVKT
LNLAGNFLERLSGLHKLYSLVNLDLRDNRIEQLDEVKSIGNLPCLEHVALLNNPLSIIPD
YRTKVLSQFGERASEICLDDVATTEKELDTVEVLKAIQKAKDVKSKLSSTEKKVGEDFRL
PTAPCIRPSSSPPTAVPTSASLPQPILSNQGIMFVQEEALASSLSSTDSLPPDDRPIAQA
CSNSMGSLPTGQVAAEDLRDLPGAVGGVSPDHAEPEVQVVPGSGQIIFLPFTCIGYTATN
QDFIQRLSTLIRQAIERQLPAWIEAANQREEAHGEQGEEEEEEEEEDVAESRYFEMGPPD
AEEEEGSGQGEEDEEDEDEEAEEERLALEWALGADEDFLLEHIRILKVLWCFLIHVQGSI
RQFAACLVLTDFGIAVFEIPHQESRGSSQHILSSLRFVFCFPHGDLTEFGFLMPELCLVL
KVRHSENTLFIISDAANLHEFHADLRSCFAPQHMAMLCSPILYGSHTSLQEFLRQLLTFY
KVAGGSQERSQGCFPVYLVYSDKRMVQTAAGDYSGNIEWASCTLCSAVRRSCCAPSEAVK
SAAIPYWLLLTSQHLNVIKADFNPMPSRGTHNCRNRNSFKLSRVPLSTVLLDPTRSCTQP
RGAFADGHVLELLVGYRFVTAIFVLPHEKFHFLRVYNQLRASLKDLKTVVIAKNPSARPR
TQGPLAGGQPAKSRVSAEQRLQETPAEAPAPAPAAAESAAEAPAAAEASAPAGAPAPAGA
PAPAGAPAGAQAPAPAQAEVPAQYPSERLIQSTSEENQIPSHLPVCPSLQHIARLRGRAI
IDLFHSSIAEVENEELRHLLWSSVVFYQTPGLEVTACVLLSTKAVYFILHDGLRRYFSEP
LQDFWHQKNTDYNNSPFHISQCFVLKLSDLQSVNVGLFDQYFRLTGSSPTQVVTCLTRDS
YLTHCFLQHLMLVLSSLERTPSPEPIDKDFYSEFGDKNTGKMENYELIHSSRVKFTYPSE
EEVGDLTYVVAQKMADPAKNPALSILLYIQAFQVITPQLGRGRGPLRPKTLLLTSAEIFL
LDEDYIHYPLPEFAKEPPQRDRYRLDDGRRVRDLDRVLMGYNPYPQALTLVFDDTQGHDL
MGSVTLDHFGEMPGGPGRAGQGREVQWQVFVPSAESREKLISLLARQWEALCGRELPVEL
TG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50021809
n/a
NameBDBM50021809
Synonyms:(2,6-Dichloro-4-iodo-phenyl)-(4,5-dihydro-1H-imidazol-2-yl)-amine | (2,6-Dichloro-4-iodo-phenyl)-imidazolidin-2-ylidene-amine (p-iodoclonidine) | CHEMBL360803 | p-iodoclonidine
TypeSmall organic molecule
Emp. Form.C9H8Cl2IN3
Mol. Mass.355.99
SMILESClc1cc(I)cc(Cl)c1\[#7]=[#6]-1\[#7]-[#6]-[#6]-[#7]-1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: