Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPotassium channel subfamily K member 10
LigandBDBM50180656
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1584400
EC50 30000±n/a nM
Citation Vivier DBennis KLesage FDucki S Perspectives on the Two-Pore Domain Potassium Channel TREK-1 (TWIK-Related K(+) Channel 1). A Novel Therapeutic Target? J Med Chem 59:5149-57 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Potassium channel subfamily K member 10
Name:Potassium channel subfamily K member 10
Synonyms:KCNK10 | Outward rectifying potassium channel protein TREK-2 | Potassium channel subfamily K member 10 | TREK-2 K(+) channel subunit | TREK2
Type:PROTEIN
Mol. Mass.:59774.98
Organism:Homo sapiens (Human)
Description:ChEMBL_105637
Residue:538
Sequence:
MFFLYTDFFLSLVAVPAAAPVCQPKSATNGQPPAPAPTPTPRLSISSRATVVARMEGTSQ
GGLQTVMKWKTVVAIFVVVVVYLVTGGLVFRALEQPFESSQKNTIALEKAEFLRDHVCVS
PQELETLIQHALDADNAGVSPIGNSSNNSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGG
KIFCILYAIFGIPLFGFLLAGIGDQLGTIFGKSIARVEKVFRKKQVSQTKIRVISTILFI
LAGCIVFVTIPAVIFKYIEGWTALESIYFVVVTLTTVGFGDFVAGGNAGINYREWYKPLV
WFWILVGLAYFAAVLSMIGDWLRVLSKKTKEEVGEIKAHAAEWKANVTAEFRETRRRLSV
EIHDKLQRAATIRSMERRRLGLDQRAHSLDMLSPEKRSVFAALDTGRFKASSQESINNRP
NNLRLKGPEQLNKHGQGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYS
LDEEKKEEETEKMCNSDNSSTAMLTDCIQQHAELENGMIPTDTKDREPENNSLLEDRN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50180656
n/a
NameBDBM50180656
Synonyms:CHEMBL3818503
TypeSmall organic molecule
Emp. Form.C18H17Cl2N5
Mol. Mass.374.267
SMILESCC1(C)c2cc(Cl)ccc2N(CCc2nnn[nH]2)c2ccc(Cl)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: