| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Stromal cell-derived factor 1 |
|---|
| Ligand | BDBM50180878 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1585148 (CHEMBL3820796) |
|---|
| Kd | 1100000±n/a nM |
|---|
| Citation |  Smith, EW; Nevins, AM; Qiao, Z; Liu, Y; Getschman, AE; Vankayala, SL; Kemp, MT; Peterson, FC; Li, R; Volkman, BF; Chen, Y Structure-Based Identification of Novel Ligands Targeting Multiple Sites within a Chemokine-G-Protein-Coupled-Receptor Interface. J Med Chem59:4342-51 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Stromal cell-derived factor 1 |
|---|
| Name: | Stromal cell-derived factor 1 |
|---|
| Synonyms: | CXCL12 | Chemokine CXCL12 | SDF1 | SDF1A | SDF1B | SDF1_HUMAN |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10677.83 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P48061 |
|---|
| Residue: | 93 |
|---|
| Sequence: | MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
|
|
|
|---|
| BDBM50180878 |
|---|
| n/a |
|---|
| Name | BDBM50180878 |
|---|
| Synonyms: | CHEMBL3818321 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H27FNO5P |
|---|
| Mol. Mass. | 399.3935 |
|---|
| SMILES | CC(C)O.CCCOc1ccc(cc1)C(Nc1ccc(F)cc1)P(O)(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
