| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase |
|---|
| Ligand | BDBM50181517 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1585632 |
|---|
| Kd | 89200±n/a nM |
|---|
| Citation |  Dennis, ML; Pitcher, NP; Lee, MD; DeBono, AJ; Wang, ZC; Harjani, JR; Rahmani, R; Cleary, B; Peat, TS; Baell, JB; Swarbrick, JD Structural Basis for the Selective Binding of Inhibitors to 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase from Staphylococcus aureus and Escherichia coli. J Med Chem59:5248-63 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase |
|---|
| Name: | 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase |
|---|
| Synonyms: | 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase | 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase | 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase | HPPK | HPPK_ECOLI | JW0138 | PPPK | folK |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18075.55 |
|---|
| Organism: | Escherichia coli (strain K12) |
|---|
| Description: | ChEMBL_108237 |
|---|
| Residue: | 159 |
|---|
| Sequence: | MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVA
LETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMK
NRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
|
|
|
|---|
| BDBM50181517 |
|---|
| n/a |
|---|
| Name | BDBM50181517 |
|---|
| Synonyms: | CHEMBL3818353 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C7H9N5O2S |
|---|
| Mol. Mass. | 227.244 |
|---|
| SMILES | Nc1nc2[nH]c(SCCO)nc2c(=O)[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
