Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLDL-associated phospholipase A2
LigandBDBM50182424
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1584543
Kd 980000±n/a nM
Citation Woolford AJPero JEAravapalli SBerdini VCoyle JEDay PJDodson AMGrondin PHolding FPLee LYLi PManas ESMarino JMartin ACMcCleland BWMcMenamin RLMurray CWNeipp CEPage LWPatel VKPotvain FRich SRivero RASmith KSomers DOTrottet LVelagaleti RWilliams GXie R Exploitation of a Novel Binding Pocket in Human Lipoprotein-Associated Phospholipase A2 (Lp-PLA2) Discovered through X-ray Fragment Screening. J Med Chem 59:5356-67 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
LDL-associated phospholipase A2
Name:LDL-associated phospholipase A2
Synonyms:1-alkyl-2-acetylglycerophosphocholine esterase | 2-acetyl-1-alkylglycerophosphocholine esterase | LDL-PLA(2) | PAF 2-acylhydrolase | PAF acetylhydrolase | Platelet-activating factor acetylhydrolase
Type:PROTEIN
Mol. Mass.:50084.41
Organism:Homo sapiens (Human)
Description:ChEMBL_156212
Residue:441
Sequence:
MVPPKLHVLFCLCGCLAVVYPFDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGN
GPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNI
LRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHGFIVAAVEHR
DRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDID
HGKPVKNALDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAWMF
PLGDEVYSRIPQPLFFINSEYFQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFA
TGKIIGHMLKLKGDIDSNVAIDLSNKASLAFLQKHLGLHKDFDQWDCLIEGDDENLIPGT
NINTTNQHIMLQNSSGIEKYN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50182424
n/a
NameBDBM50182424
Synonyms:CHEMBL3818090
TypeSmall organic molecule
Emp. Form.C11H10FNO
Mol. Mass.191.2016
SMILESFc1cccc(c1)C(=O)N1CC=CC1 |c:12|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: