Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTGF-beta receptor type I
LigandBDBM50183449
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1586818
IC50 5140±n/a nM
Citation Martin LJKoegl MBader GCockcroft XLFedorov OFiegen DGerstberger THofmann MHHohmann AFKessler DKnapp SKnesl PKornigg SMüller SNar HRogers CRumpel KSchaaf OSteurer STallant CVakoc CRZeeb MZoephel APearson MBoehmelt GMcConnell D Structure-Based Design of an in Vivo Active Selective BRD9 Inhibitor. J Med Chem 59:4462-75 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
TGF-beta receptor type I
Name:TGF-beta receptor type I
Synonyms:2.7.11.30 | ALK-5 | ALK5 | ALK5 | ALK5/TGFBR1 | Activin A receptor type II-like protein kinase of 53kD | Activin receptor-like kinase 5 | Activin receptor-like kinase 5 (ALK-5) | Activin receptor-like kinase 5 (ALK5/TGFbeta) | P36897 | SKR4 | TGF-beta receptor type-1 | TGF-beta receptor type-1 (TGFR1) | TGFBR1 | Transforming Growth Factor
Type:n/a
Mol. Mass.:55968.24
Organism:Homo sapiens (Human)
Description:n/a
Residue:503
Sequence:
MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTE
TTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPG
LGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL
IYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
GMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS
ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI
HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGA
ARLTALRIKKTLSQLSQQEGIKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50183449
n/a
NameBDBM50183449
Synonyms:CHEMBL3823101
TypeSmall organic molecule
Emp. Form.C20H23N3O3
Mol. Mass.353.4149
SMILESCOc1cc(c(OC)cc1CN(C)C)-c1cn(C)c(=O)c2cnccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: