Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetActivin receptor type-2B
LigandBDBM50183449
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1586819
IC50 7680±n/a nM
Citation Martin LJKoegl MBader GCockcroft XLFedorov OFiegen DGerstberger THofmann MHHohmann AFKessler DKnapp SKnesl PKornigg SMüller SNar HRogers CRumpel KSchaaf OSteurer STallant CVakoc CRZeeb MZoephel APearson MBoehmelt GMcConnell D Structure-Based Design of an in Vivo Active Selective BRD9 Inhibitor. J Med Chem 59:4462-75 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Activin receptor type-2B
Name:Activin receptor type-2B
Synonyms:ACVR2B | Activin receptor type-2B
Type:Enzyme Catalytic Domain
Mol. Mass.:57713.76
Organism:Homo sapiens (Human)
Description:gi_116734708
Residue:512
Sequence:
MTAPWVALALLWGSLCAGSGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCY
ASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG
GPEVTYEPPPTAPTLLTVLAYSLLPIGGLSLIVLLAFWMYRHRKPPYGHVDIHEDPGPPP
PSPLVGLKPLQLLEIKARGRFGCVWKAQLMNDFVAVKIFPLQDKQSWQSEREIFSTPGMK
HENLLQFIAAEKRGSNLEVELWLITAFHDKGSLTDYLKGNIITWNELCHVAETMSRGLSY
LHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAVLADFGLAVRFEPGKPPGDTHGQVG
TRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADGPVDEYMLPFEEEIGQ
HPSLEELQEVVVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAEARLSAGCVEERVSL
IRRSVNGTTSDCLVSLVTSVTNVDLPPKESSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50183449
n/a
NameBDBM50183449
Synonyms:CHEMBL3823101
TypeSmall organic molecule
Emp. Form.C20H23N3O3
Mol. Mass.353.4149
SMILESCOc1cc(c(OC)cc1CN(C)C)-c1cn(C)c(=O)c2cnccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: