Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 9
LigandBDBM50183517
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1586798
IC50 128±n/a nM
Citation Martin LJKoegl MBader GCockcroft XLFedorov OFiegen DGerstberger THofmann MHHohmann AFKessler DKnapp SKnesl PKornigg SMüller SNar HRogers CRumpel KSchaaf OSteurer STallant CVakoc CRZeeb MZoephel APearson MBoehmelt GMcConnell D Structure-Based Design of an in Vivo Active Selective BRD9 Inhibitor. J Med Chem 59:4462-75 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 9
Name:Bromodomain-containing protein 9
Synonyms:BRD9 | Bromodomain-containing protein 9 | Rhabdomyosarcoma antigen MU-RMS-40.8
Type:PROTEIN
Mol. Mass.:66994.30
Organism:Homo sapiens (Human)
Description:ChEMBL_108000
Residue:597
Sequence:
MGKKHKKHKAEWRSSYEDYADKPLEKPLKLVLKVGGSEVTELSGSGHDSSYYDDRSDHER
ERHKEKKKKKKKKSEKEKHLDDEERRKRKEEKKRKREREHCDTEGEADDFDPGKKVEVEP
PPDRPVRACRTQPAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHP
MDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQ
AALLGNEDTAVEEPVPEVVPVQVETAKKSKKPSREVISCMFEPEGNACSLTDSTAEEHVL
ALVEHAADEARDRINRFLPGGKMGYLKRNGDGSLLYSVVNTAEPDADEEETHPVDLSSLS
SKLLPGFTTLGFKDERRNKVTFLSSATTALSMQNNSVFGDLKSDEMELLYSAYGDETGVQ
CALSLQEFVKDAGSYSKKVVDDLLDQITGGDHSRTLFQLKQRRNVPMKPPDEAKVGDTLG
DSSSSVLEFMSMKSYPDVSVDISMLSSLGKVKKELDPDDSHLNLDETTKLLQDLHEAQAE
RGGSRPSSNLSSLSNASERDQHHLGSPSRLSVGEQPDVTHDPYEFLQSPEPAASAKT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50183517
n/a
NameBDBM50183517
Synonyms:CHEMBL3823859
TypeSmall organic molecule
Emp. Form.C20H23N3O3
Mol. Mass.353.4149
SMILESCOc1cc(cc(OC)c1CN(C)C)-c1cn(C)c(=O)c2ccncc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: