Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase RIPK2
LigandBDBM50184725
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1587102
IC50 20±n/a nM
Citation Haile PAVotta BJMarquis RWBury MJMehlmann JFSinghaus RCharnley AKLakdawala ASConvery MALipshutz DBDesai BMSwift BCapriotti CABerger SBMahajan MKReilly MARivera EJSun HHNagilla RBeal AMFinger JNCook MNKing BWOuellette MTTotoritis RDPierdomenico MNegroni AStronati LCucchiara SZiólkowski BVossenkämper AMacDonald TTGough PJBertin JCasillas LN The Identification and Pharmacological Characterization of 6-(tert-Butylsulfonyl)-N-(5-fluoro-1H-indazol-3-yl)quinolin-4-amine (GSK583), a Highly Potent and Selective Inhibitor of RIP2 Kinase. J Med Chem 59:4867-80 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase RIPK2
Name:Serine/threonine-protein kinase RIPK2
Synonyms:Tyrosine-protein kinase RIPK2 | receptor-interacting serine/threonine-protein kinase 2
Type:Protein
Mol. Mass.:61201.30
Organism:Homo sapiens (Human)
Description:n/a
Residue:540
Sequence:
MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSER
KDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPL
RFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRS
SKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMY
SVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEI
TFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQLHENSGSPET
SRSLPAPQDNDFLSRKAQDCYFMKLHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIIN
PLSTAGNSERLQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTK
PTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50184725
n/a
NameBDBM50184725
Synonyms:CHEMBL3824056
TypeSmall organic molecule
Emp. Form.C23H25N3O3
Mol. Mass.391.4629
SMILESCc1ccc(O)cc1Nc1ccnc2ccc(cc12)C(=O)NCC1CCOCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: