Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase Yes
LigandBDBM50184769
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1587942
IC50 71±n/a nM
Citation Fraser CDawson JCDowling RHouston DRWeiss JTMunro AFMuir MHarrington LWebster SPFrame MCBrunton VGPatton EECarragher NOUnciti-Broceta A Rapid Discovery and Structure-Activity Relationships of Pyrazolopyrimidines That Potently Suppress Breast Cancer Cell Growth via SRC Kinase Inhibition with Exceptional Selectivity over ABL Kinase. J Med Chem 59:4697-710 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase Yes
Name:Tyrosine-protein kinase Yes
Synonyms:Proto-oncogene c-Yes | YES1 | p61-yes
Type:Protein
Mol. Mass.:60801.54
Organism:Homo sapiens (Human)
Description:P07947
Residue:543
Sequence:
MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMT
PFGGSSGVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQI
INNTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRG
IFLVRESETTKGAYSLSIRDWDEIRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHY
TEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTT
KVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFL
KEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARL
IEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNRE
VLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPG
ENL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50184769
n/a
NameBDBM50184769
Synonyms:CHEMBL3823212
TypeSmall organic molecule
Emp. Form.C21H29N7
Mol. Mass.379.5019
SMILESCN(C)C1CCN(CCn2nc(-c3ccc(C)cc3)c3c(N)ncnc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: