Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPatatin-like phospholipase domain-containing protein 2
LigandBDBM50185419
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1587882
IC50 700±n/a nM
Citation Roy PPD'Souza KCuperlovic-Culf MKienesberger PCTouaibia M New Atglistatin closely related analogues: Synthesis and structure-activity relationship towards adipose triglyceride lipase inhibition. Eur J Med Chem 118:290-8 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Patatin-like phospholipase domain-containing protein 2
Name:Patatin-like phospholipase domain-containing protein 2
Synonyms:ATGL | Adipose triglyceride lipase | Calcium-independent phospholipase A2 | Desnutrin | IPLA2-zeta | PNPLA2 | Patatin-like phospholipase domain-containing protein 2 | Pigment epithelium-derived factor | TTS2 | TTS2.2 | Transport-secretion protein 2
Type:PROTEIN
Mol. Mass.:55319.31
Organism:Homo sapiens (Human)
Description:ChEMBL_116817
Residue:504
Sequence:
MFPREKTWNISFAGCGFLGVYYVGVASCLREHAPFLVANATHIYGASAGALTATALVTGV
CLGEAGAKFIEVSKEARKRFLGPLHPSFNLVKIIRSFLLKVLPADSHEHASGRLGISLTR
VSDGENVIISHFNSKDELIQANVCSGFIPVYCGLIPPSLQGVRYVDGGISDNLPLYELKN
TITVSPFSGESDICPQDSSTNIHELRVTNTSIQFNLRNLYRLSKALFPPEPLVLREMCKQ
GYRDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQAVESAQAEDYSQLPGEDHILEHL
PARLNEALLEACVEPTDLLTTLSNMLPVRLATAMMVPYTLPLESALSFTIRLLEWLPDVP
EDIRWMKEQTGSICQYLVMRAKRKLGRHLPSRLPEQVELRRVQSLPSVPLSCAAYREALP
GWMRNNLSLGDALAKWEECQRQLLLGLFCTNVAFPPEALRMRAPADPAPAPADPASPQHQ
LAGPAPLLSTPAPEARPVIGALGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50185419
n/a
NameBDBM50185419
Synonyms:CHEMBL3823931
TypeSmall organic molecule
Emp. Form.C17H21N3O
Mol. Mass.283.3681
SMILESCN(C)C(=O)Nc1cccc(c1)-c1ccc(cc1)N(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: