| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fatty acid-binding protein, adipocyte |
|---|
| Ligand | BDBM53262 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1589882 (CHEMBL3830762) |
|---|
| Ki | 2300±n/a nM |
|---|
| Citation |  Zhou, Y; Nie, T; Zhang, Y; Song, M; Li, K; Ding, M; Ding, K; Wu, D; Xu, Y The discovery of novel and selective fatty acid binding protein 4 inhibitors by virtual screening and biological evaluation. Bioorg Med Chem24:4310-4317 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fatty acid-binding protein, adipocyte |
|---|
| Name: | Fatty acid-binding protein, adipocyte |
|---|
| Synonyms: | A-FABP | AFABP | ALBP | Adipocyte lipid-binding protein | FABP4 | FABP4_HUMAN | Fatty acid binding protein adipocyte | Fatty acid-binding protein 4 | Fatty acid-binding protein 4 (FABP4) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 14719.23 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P15090 |
|---|
| Residue: | 132 |
|---|
| Sequence: | MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
KGVTSTRVYERA
|
|
|
|---|
| BDBM53262 |
|---|
| n/a |
|---|
| Name | BDBM53262 |
|---|
| Synonyms: | 2-[4-[(4-chlorophenyl)sulfonylamino]-1-hydroxynaphthalen-2-yl]sulfanylacetic acid | 2-[4-[(4-chlorophenyl)sulfonylamino]-1-oxidanyl-naphthalen-2-yl]sulfanylethanoic acid | 2-[[4-[(4-chlorophenyl)sulfonylamino]-1-hydroxy-2-naphthalenyl]thio]acetic acid | 2-[[4-[(4-chlorophenyl)sulfonylamino]-1-hydroxy-2-naphthyl]thio]acetic acid | MLS001196186 | SMR000558496 | [(4-{[(4-chlorophenyl)sulfonyl]amino}-1-hydroxy-2-naphthyl)thio]acetic acid | cid_1309516 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H14ClNO5S2 |
|---|
| Mol. Mass. | 423.89 |
|---|
| SMILES | OC(=O)CSc1cc(NS(=O)(=O)c2ccc(Cl)cc2)c2ccccc2c1O |
|---|
| Structure | 
|
|---|
Search and Browse
