Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosinase
LigandBDBM26189
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1590349
IC50 652000±n/a nM
Citation Garcia-Jimenez ATeruel-Puche JABerna JRodriguez-Lopez JNTudela JGarcia-Ruiz PAGarcia-Canovas F Characterization of the action of tyrosinase on resorcinols. Bioorg Med Chem 24:4434-4443 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Tyrosinase
Name:Tyrosinase
Synonyms:Monophenol monooxygenase | Monophenol oxidase
Type:Protein
Mol. Mass.:63923.66
Organism:Agaricus bisporus (Common mushroom)
Description:O42713
Residue:556
Sequence:
MSLIATVGPTGGVKNRLNIVDFVKNEKFFTLYVRSLELLQAKEQHDYSSFFQLAGIHGLP
FTEWAKERPSMNLYKAGYCTHGQVLFPTWHRTYLSVLEQILQGAAIEVAKKFTSNQTDWV
QAAQDLRQPYWDWGFELMPPDEVIKNEEVNITNYDGKKISVKNPILRYHFHPIDPSFKPY
GDFATWRTTVRNPDRNRREDIPGLIKKMRLEEGQIREKTYNMLKFNDAWERFSNHGISDD
QHANSLESVHDDIHVMVGYGKIEGHMDHPFFAAFDPIFWLHHTNVDRLLSLWKAINPDVW
VTSGRNRDGTMGIAPNAQINSETPLEPFYQSGDKVWTSASLADTARLGYSYPDFDKLVGG
TKELIRDAIDDLIDERYGSKPSSGARNTAFDLLADFKGITKEHKEDLKMYDWTIHVAFKK
FELKESFSLLFYFASDGGDYDQENCFVGSINAFRGTAPETCANCQDNENLIQEGFIHLNH
YLARDLESFEPQDVHKFLKEKGLSYKLYSRGDKPLTSLSVKIEGRPLHLPPGEHRPKYDH
TQARVVFDDVAVHVIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26189
n/a
NameBDBM26189
Synonyms:α-CA inhibitor, 13 | 1,3-Dihydroxybenzene, XII | 1,3-dihydroxybenzene | CHEMBL24147 | US9688816, 4 | benzene-1,3-diol | phenol derivative, 3
TypeSmall organic molecule
Emp. Form.C6H6O2
Mol. Mass.110.1106
SMILESOc1cccc(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: