Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLDL-associated phospholipase A2
LigandBDBM50162136
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1589118
Kd 1.9±n/a nM
Citation Liu QChen XChen WYuan XSu HShen JXu Y Structural and Thermodynamic Characterization of Protein-Ligand Interactions Formed between Lipoprotein-Associated Phospholipase A2 and Inhibitors. J Med Chem 59:5115-20 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
LDL-associated phospholipase A2
Name:LDL-associated phospholipase A2
Synonyms:1-alkyl-2-acetylglycerophosphocholine esterase | 2-acetyl-1-alkylglycerophosphocholine esterase | LDL-PLA(2) | PAF 2-acylhydrolase | PAF acetylhydrolase | Platelet-activating factor acetylhydrolase
Type:PROTEIN
Mol. Mass.:50084.41
Organism:Homo sapiens (Human)
Description:ChEMBL_156212
Residue:441
Sequence:
MVPPKLHVLFCLCGCLAVVYPFDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGN
GPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNI
LRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHGFIVAAVEHR
DRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDID
HGKPVKNALDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAWMF
PLGDEVYSRIPQPLFFINSEYFQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFA
TGKIIGHMLKLKGDIDSNVAIDLSNKASLAFLQKHLGLHKDFDQWDCLIEGDDENLIPGT
NINTTNQHIMLQNSSGIEKYN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50162136
n/a
NameBDBM50162136
Synonyms:CHEMBL3792924
TypeSmall organic molecule
Emp. Form.C23H19ClF5N3O5S
Mol. Mass.579.924
SMILESCn1c(cc(OCc2cc(F)c(Oc3ccc(Cl)c(c3)C(F)(F)F)c(F)c2)nc1=O)N1CCS(=O)(=O)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: