Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutamate carboxypeptidase II
LigandBDBM50187705
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1589259
IC50 28±n/a nM
Citation Subedi MMinn IChen JKim YOk KJung YWPomper MGByun Y Design, synthesis and biological evaluation of PSMA/hepsin-targeted heterobivalent ligands. Eur J Med Chem 118:208-218 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Glutamate carboxypeptidase II
Name:Glutamate carboxypeptidase II
Synonyms:FGCP | Folate hydrolase 1 | Folylpoly-gamma-glutamate carboxypeptidase | Glutamate carboxypeptidase 2 | Membrane glutamate carboxypeptidase | N-acetylated-alpha-linked acidic dipeptidase I | NAALADase I | PSM | PSMA | Prostate-specific membrane antigen | Pteroylpoly-gamma-glutamate carboxypeptidase | mGCP
Type:PROTEIN
Mol. Mass.:84333.66
Organism:Homo sapiens (Human)
Description:ChEMBL_1497035
Residue:750
Sequence:
MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKA
FLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYP
NKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYA
RTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVK
SYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYY
DAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIG
TLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFAS
WDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKE
LKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKN
WETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDY
AVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIV
LRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVD
PSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50187705
n/a
NameBDBM50187705
Synonyms:CHEMBL3828668
TypeSmall organic molecule
Emp. Form.C85H104N11O18S2
Mol. Mass.1631.929
SMILESCN1\C(=C\C=C2/CCCC(\C=C\C3=[N+](CCCCCC(=O)NCCCCC(NC(=O)CCCCCCC(=O)NCCCCC(NC(=O)NC(CCC(O)=O)C(O)=O)C(O)=O)C(=O)NCc4ccc(cc4)-c4ccc(O)c(c4)-c4cc5cc(ccc5[nH]4)C(N)=N)c4ccc(cc4C3(C)C)S([O-])(=O)=O)=C2)C(C)(C)c2cc(ccc12)S([O-])(=O)=O |c:12,107|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: