Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHepsin
LigandBDBM50187711
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1589258
IC50 5900±n/a nM
Citation Subedi MMinn IChen JKim YOk KJung YWPomper MGByun Y Design, synthesis and biological evaluation of PSMA/hepsin-targeted heterobivalent ligands. Eur J Med Chem 118:208-218 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Hepsin
Name:Hepsin
Synonyms:Serine protease hepsin | Transmembrane protease, serine 1
Type:Enzyme
Mol. Mass.:45016.98
Organism:Homo sapiens (Human)
Description:Human deglycosylated hepsin was expressed in Pichia pastoris.
Residue:417
Sequence:
MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSAD
ARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCV
DEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSL
RYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYH
GGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQ
YYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCE
DSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50187711
n/a
NameBDBM50187711
Synonyms:CHEMBL3827463
TypeSmall organic molecule
Emp. Form.C21H16FN3O
Mol. Mass.345.3696
SMILESNC(=N)c1ccc2[nH]c(cc2c1)-c1cc(ccc1O)-c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: