Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlatelet-activating factor acetylhydrolase IB subunit beta
LigandBDBM50188240
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1589935
IC50 6000±n/a nM
Citation Sarma BKLiu XKodadek T Identification of selective covalent inhibitors of platelet activating factor acetylhydrolase 1B2 from the screening of an oxadiazolone-capped peptoid-azapeptoid hybrid library. Bioorg Med Chem 24:3953-3963 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Platelet-activating factor acetylhydrolase IB subunit beta
Name:Platelet-activating factor acetylhydrolase IB subunit beta
Synonyms:PAF acetylhydrolase 30 kDa subunit | PAF-AH 30 kDa subunit | PAF-AH subunit beta | PAFAH subunit beta | PAFAH1B2 | PAFAHB | Platelet-activating factor acetylhydrolase IB subunit beta
Type:PROTEIN
Mol. Mass.:25565.45
Organism:Homo sapiens (Human)
Description:ChEMBL_18054
Residue:229
Sequence:
MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWR
ELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEA
IVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFV
HSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50188240
n/a
NameBDBM50188240
Synonyms:CHEMBL3827226
TypeSmall organic molecule
Emp. Form.C69H79BrClN17O16S
Mol. Mass.1549.892
SMILESCOCCN(CC(=O)N(CCCCN)CC(=O)N(CCCCN)CC(N)=O)C(=O)CN(NC(=O)c1ccc(OC)cc1)C(=O)CN(NC(=O)Nc1ccccc1)C(=O)CN(NC(=O)c1ccc(Cl)cc1)C(=O)CN(NC(=O)Cc1ccccc1)C(=O)Cn1nc(oc1=O)-c1ccc(s1)-c1ccc(Br)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: