Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-dependent kinase 8
LigandBDBM50189415
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1589660
IC50 1.7±n/a nM
Citation Mallinger ASchiemann KRink CSejberg JHoney MACzodrowski PStubbs MPoeschke OBusch MSchneider RSchwarz DMusil DBurke RUrbahns KWorkman PWienke DClarke PARaynaud FIEccles SAEsdar CRohdich FBlagg J 2,8-Disubstituted-1,6-Naphthyridines and 4,6-Disubstituted-Isoquinolines with Potent, Selective Affinity for CDK8/19. ACS Med Chem Lett 7:573-8 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cyclin-dependent kinase 8
Name:Cyclin-dependent kinase 8
Synonyms:CDK8 | Cell division protein kinase 8 | Cyclin-Dependent Kinase 8 (CDK8) | Mediator complex subunit CDK8 | Mediator of RNA polymerase II transcription subunit CDK8 | Protein kinase K35
Type:Serine/threonine-protein kinase
Mol. Mass.:53300.21
Organism:Homo sapiens (Human)
Description:P49336
Residue:464
Sequence:
MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGIS
MSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKP
VQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLF
NSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQED
IKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKH
KVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLT
EEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTS
DYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50189415
n/a
NameBDBM50189415
Synonyms:CHEMBL3828637
TypeSmall organic molecule
Emp. Form.C18H16N4O3S
Mol. Mass.368.41
SMILESCNC(=O)c1ccc2cncc(-c3ccc4N(C)S(=O)(=O)Cc4c3)c2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: