Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-C
LigandBDBM50189447
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1589659
IC50 1.1±n/a nM
Citation Mallinger ASchiemann KRink CSejberg JHoney MACzodrowski PStubbs MPoeschke OBusch MSchneider RSchwarz DMusil DBurke RUrbahns KWorkman PWienke DClarke PARaynaud FIEccles SAEsdar CRohdich FBlagg J 2,8-Disubstituted-1,6-Naphthyridines and 4,6-Disubstituted-Isoquinolines with Potent, Selective Affinity for CDK8/19. ACS Med Chem Lett 7:573-8 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cyclin-C
Name:Cyclin-C
Synonyms:CCNC | Cyclin C | SRB11 homolog | hSRB11
Type:PROTEIN
Mol. Mass.:33244.88
Organism:Homo sapiens (Human)
Description:ChEMBL_107900
Residue:283
Sequence:
MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQ
VIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRF
SYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIV
NDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQ
WKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50189447
n/a
NameBDBM50189447
Synonyms:CHEMBL3828553
TypeSmall organic molecule
Emp. Form.C23H22N6O2
Mol. Mass.414.4598
SMILESCOC1CN(C1)C(=O)c1ccc2c(N)ncc(-c3ccc(cc3)-c3cnn(C)c3)c2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: